Talk:Big gastrin
 | This article is rated Stub-class on Wikipedia's content assessment scale. It is of interest to the following WikiProjects: | ||||||||||
| |||||||||||
Untitled
[edit]I'm dubious about the structure described by the SMILES string, which is H-Pyr-Leu-Gly-Gly-Gln-Gly-Pro-Gly-Gly-Gly-Gly-Ala-Asp-Gly-Gly-Lys-Lys-Gln-Gly-Pro-Gly-Gly-Glu-Glu-Glu-Glu-Gly-Ala-Gly-Gly-Trp-Met-Asp-Phe-NH2 or XLGGQGPGGGGADGGKKQGPGGEEEEGAGGWMDF. Could someone with access to the academic literature identify the true sequence and add it to the article? Leave a note here and I can then generate the SMILES (and InChI, etc.) from that. Baoilleach (talk) 12:09, 18 September 2015 (UTC)
Wiki Education Foundation-supported course assignment
[edit]
This article was the subject of a Wiki Education Foundation-supported course assignment, between 28 January 2019 and 15 May 2019. Further details are available on the course page. Student editor(s): Eliseomosso.
Above undated message substituted from Template:Dashboard.wikiedu.org assignment by PrimeBOT (talk) 11:18, 18 January 2022 (UTC)
Wiki Education Foundation-supported course assignment
[edit] This article was the subject of a Wiki Education Foundation-supported course assignment, between 26 August 2020 and 18 December 2020. Further details are available on the course page. Student editor(s): QiwenJiang.
Above undated message substituted from Template:Dashboard.wikiedu.org assignment by PrimeBOT (talk) 11:18, 18 January 2022 (UTC)